DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:231 Identity:86/231 - (37%)
Similarity:113/231 - (48%) Gaps:19/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVER---PFDTLYSVRVGSVWKN 84
            ::.||......|.||||:|..:..:.|||.:.|:..:||||||..|   |.|  :.|..|.:...
  Rat   186 KVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFVRSANPKD--WKVSFGFLLSK 248

  Fly    85 LGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAP--AAGTEASVSGW 147
            ...|.| |..|..||:| |.....|||||:||...:::...:|...|.::..  ...::..|:||
  Rat   249 PQAQRA-VKSIVIHENY-SYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVVVTGW 311

  Fly   148 GEIGILWLQPTSLLKTSVKILDPNVCKRSYQY---ITKTMICAAAL--LKDSCHGDSGGPLVSGG 207
            |.:......|..|.|..|||:|...|.....|   ||..|:||..|  ..|:|.|||||||||..
  Rat   312 GTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGRVDACQGDSGGPLVSED 376

  Fly   208 Q-----LVGIVSYGIGCANPFFPGVYANVAELKPWI 238
            .     |.||||:|..||.|..||||..|...:.||
  Rat   377 SKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 84/229 (37%)
Tryp_SPc 24..238 CDD:238113 84/228 (37%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 84/229 (37%)
Tryp_SPc 187..415 CDD:238113 86/230 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.