DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Klk4

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:257 Identity:82/257 - (31%)
Similarity:125/257 - (48%) Gaps:31/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLV--LVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSE--KYICGAVIYSDKIIITAAHC 65
            |.:  |:..||..||.|...||:.|...|....|||||| :||  .:.|..|:...:.:::||||
  Rat    11 WFLGYLILEVTGSSASSISSRIIQGQDCLPHSQPWQAAL-FSEDNAFFCSGVLVHPQWVLSAAHC 74

  Fly    66 VERPFDTLYSVRVGSVWKNLGGQ--------HARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIF 122
            ::.      |..||....||.|.        .|.:::  :|.:| :.....||:.:|:|.::::.
  Rat    75 IQD------SYTVGLGLHNLEGSQEPGSRMLEAHLSI--QHPNY-NDPSFANDLMLIKLNESVME 130

  Fly   123 NAEVRPIQLADSAPAAGTEASVSGWGEI--GILWLQPTSLLKTSVKILDPNVCKRSYQYITK-TM 184
            :..:|.|.:|...|..|....|||||.:  |.|   |:.|...::.:.....|:..|..:.. :|
  Rat   131 SNTIRRIPVASQCPTPGDTCLVSGWGRLKNGKL---PSLLQCVNLSVASEETCRLLYDPVYHLSM 192

  Fly   185 ICAAA--LLKDSCHGDSGGPLVSGGQLVGIVSYGIG-CANPFFPGVYANVAELKPWILNAIE 243
            .||..  ..||:|:||||||:|....|.|:||.|.| |..|..|.||.|:.:...||...|:
  Rat   193 FCAGGGPDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWIWTTIQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 72/230 (31%)
Tryp_SPc 24..238 CDD:238113 71/229 (31%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 70/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.