DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG10587

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:267 Identity:85/267 - (31%)
Similarity:126/267 - (47%) Gaps:70/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGHPVLISEV-PWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLG 86
            |:|||.....::: .:..||.|...::||..:..|.|::|||||.      |..|:: |.|..:|
  Fly    45 RVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCF------LGRVKI-SDWLAVG 102

  Fly    87 G---------QHARVAVIRK---HEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQ--------L 131
            |         |.....||:.   .||.::.     |:|::||         .:|::        |
  Fly   103 GASKLNDRGIQRQVKEVIKSAEFREDDMNM-----DVAILRL---------KKPMKGKSLGQLIL 153

  Fly   132 ADSAPAAGTEASVSGWG-----EIGILWLQPTSLLKT-SVKILDPNVCKRSY------------- 177
            .......|||..|||||     |.|     |..||:| :|.::|...|:.||             
  Fly   154 CKKQLMPGTELRVSGWGLTENSEFG-----PQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDL 213

  Fly   178 ---QYITKTMICAAAL-LKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWI 238
               .::|.:|.||..| .||:|..|||||||...|:.||||:|||||:..:.|||.::..:||:|
  Fly   214 FLKVHLTDSMFCAGVLGKKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFI 278

  Fly   239 LNAIEQL 245
            ..:|:.|
  Fly   279 EQSIKVL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 82/258 (32%)
Tryp_SPc 24..238 CDD:238113 81/257 (32%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 82/258 (32%)
Tryp_SPc 46..280 CDD:238113 82/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.