DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG11037

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:251 Identity:90/251 - (35%)
Similarity:138/251 - (54%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VASVTLISAGSSPE-RIVGGHPVLISEV-PWQAALMYSEKYICGAVIYSDKIIITAAHC-VERPF 70
            ||.:..|...|..| |::|||....::: .:..||:|.:.::||..:.::.|::||||| :.|..
  Fly    46 VAQLAKIVLPSPHETRVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMK 110

  Fly    71 DTLYSVRVGSVWKNLGGQHARVAVIRKH-EDYVSS-----TILFNDIAVIRLVDTLIFNAEVRPI 129
            .:.:.|..|....|..|       ||:| :|::.|     ..:..|:||: |:.|.:....:..:
  Fly   111 ASEWIVAAGISNLNQKG-------IRRHVKDFILSEQFREDDMNMDVAVV-LLKTPLKAKNIGTL 167

  Fly   130 QLADSAPAAGTEASVSGWGEIGILWLQPTSLLKT-SVKILDPNVCKRSYQ---YITKTMICAAAL 190
            .|...:...|.|..|||||........|.:||:| :|.|:....|:.:||   .||.:|||||.|
  Fly   168 SLCSVSLKPGVELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVL 232

  Fly   191 -LKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQL 245
             .||:|..|||||||...|:.||||:|||||:..:||||.:|..:||:|..:|:.|
  Fly   233 GRKDACTFDSGGPLVFKKQVCGIVSFGIGCASNRYPGVYTDVMYVKPFIEKSIKAL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 82/227 (36%)
Tryp_SPc 24..238 CDD:238113 81/226 (36%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 82/227 (36%)
Tryp_SPc 62..283 CDD:238113 82/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.