DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and PRSS57

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_999875.2 Gene:PRSS57 / 400668 HGNCID:31397 Length:283 Species:Homo sapiens


Alignment Length:264 Identity:79/264 - (29%)
Similarity:126/264 - (47%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLI----SAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCV 66
            |:.||:..::    .|||...:|:|||.|.....|:.|::.:..::.||..:...:.:::||||.
Human    12 LLTVATALMLPVKPPAGSWGAQIIGGHEVTPHSRPYMASVRFGGQHHCGGFLLRARWVVSAAHCF 76

  Fly    67 ERPFDTLYSVRVGSVWKNLGGQHA-----------RVAVIRKHEDYVSSTILFNDIAVIRLVDTL 120
            ..     ..:|.|.|   :.|.|.           .:..:..|.||...|.. |||.::||..:.
Human    77 SH-----RDLRTGLV---VLGAHVLSTAEPTQQVFGIDALTTHPDYHPMTHA-NDICLLRLNGSA 132

  Fly   121 IFNAEV---RPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQ-YIT 181
            :....|   ||.......|.|||...|:|||.:......|..|::..|::|||:||..|:: ::|
Human   133 VLGPAVGLLRPPGRRARPPTAGTRCRVAGWGFVSDFEELPPGLMEAKVRVLDPDVCNSSWKGHLT 197

  Fly   182 KTMICAAALLKDS-----CHGDSGGPLVSGGQLVGIVSY-GIGCANPFFPGVYANVAELKPWILN 240
            .||:|..:  .||     |..|||||||...:..|:||: |:.|.:|..|.||..|:....||.:
Human   198 LTMLCTRS--GDSHRRGFCSADSGGPLVCRNRAHGLVSFSGLWCGDPKTPDVYTQVSAFVAWIWD 260

  Fly   241 AIEQ 244
            .:.:
Human   261 VVRR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 71/235 (30%)
Tryp_SPc 24..238 CDD:238113 71/234 (30%)
PRSS57NP_999875.2 Tryp_SPc 34..258 CDD:238113 71/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.