DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG32374

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:235 Identity:86/235 - (36%)
Similarity:119/235 - (50%) Gaps:30/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHC-VERPFDTLYSVRVGSVWKN 84
            |.|||.|..:..|..|:|.||.|:..:|||.||.:.:.|:||.|| :..|  ..|:||.||..:.
  Fly    71 PTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNP--GRYTVRAGSTQQR 133

  Fly    85 LGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEA-----SV 144
            .|||...|.....|.:| |...:.||:.:::|...|.....|:.::|    |:..|:.     ..
  Fly   134 RGGQLRHVQKTVCHPNY-SEYTMKNDLCMMKLKTPLNVGRCVQKVKL----PSTRTKRFPKCYLA 193

  Fly   145 SGWGEIGI------LWLQPTSLLKTS-VKILDPNVCKRSYQ----YITKTMICAAALLKDSCHGD 198
            ||||....      .:|:...:.|.| .|      |::.|:    .|.|.||||....:|:|.||
  Fly   194 SGWGLTSANAQNVQRYLRGVIVCKVSRAK------CQQDYRGTGIKIYKQMICAKRKNRDTCSGD 252

  Fly   199 SGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWI 238
            ||||||..|.|.||.|:|||||:..:||||.||.:...||
  Fly   253 SGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 83/231 (36%)
Tryp_SPc 24..238 CDD:238113 82/230 (36%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 83/231 (36%)
Tryp_SPc 74..295 CDD:238113 84/232 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443387
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.