DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG32271

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:262 Identity:88/262 - (33%)
Similarity:129/262 - (49%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVL-VASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVER 68
            |||| :..:...::..:..|||||.||.|:.||:...|.....::||..:.:.:.::||||||  
  Fly     5 WLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCV-- 67

  Fly    69 PFDTLYSVRVGSVWKNLGGQHARV--AVIRKHEDYVSSTI-------------LFNDIAVIRLVD 118
                          |.:|.....|  .|.|..|..|.|.:             |.:|:||::| .
  Fly    68 --------------KGIGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKL-K 117

  Fly   119 TLIFNAEVRPIQLADSAPAAGTEASVSGWGEI----GILWLQPTSLLKTSVKILDPNVCKRSYQY 179
            ..|...:|..|:|.:::..||....|||||:|    ..:.:|..|:   .|.::....|...|:.
  Fly   118 APISGPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSV---DVALIPRKACMSQYKL 179

  Fly   180 ---ITKTMICAAAL-LKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILN 240
               ||.||.||:.. :||:|.||||||.|..|||.||||:|:|||....||||.||..::.:|..
  Fly   180 RGTITNTMFCASVPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDK 244

  Fly   241 AI 242
            |:
  Fly   245 AL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 82/237 (35%)
Tryp_SPc 24..238 CDD:238113 81/236 (34%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 82/237 (35%)
Tryp_SPc 25..244 CDD:238113 82/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.