DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and KLK2

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_005542.1 Gene:KLK2 / 3817 HGNCID:6363 Length:261 Species:Homo sapiens


Alignment Length:269 Identity:88/269 - (32%)
Similarity:127/269 - (47%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 W-LVLVASVTLISAGSSP---ERIVGGHPVLISEVPWQAALMYSEKYI-CGAVIYSDKIIITAAH 64
            | |||..::::...|:.|   .|||||........|||.| :||..:. ||.|:...:.::||||
Human     2 WDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVA-VYSHGWAHCGGVLVHPQWVLTAAH 65

  Fly    65 CVERPFDTLYSVRVGSVWKNLGGQH---------ARVAV------------IRKHEDYVSSTILF 108
            |:::.         ..||.   |:|         .||.|            :.||:.........
Human    66 CLKKN---------SQVWL---GRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSS 118

  Fly   109 NDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWGEI-GILWLQPTSLLKTSVKILDPNV 172
            :|:.::||.:.......|:.:.|....||.||....||||.| ...:|:|.||...|:.:|..::
Human   119 HDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDM 183

  Fly   173 CKRSY-QYITKTMICAAALL--KDSCHGDSGGPLVSGGQLVGIVSYG-IGCANPFFPGVYANVAE 233
            |.|:| :.:|:.|:||....  ||:|.||||||||..|.|.||.|:| ..||.|..|.||..|..
Human   184 CARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVH 248

  Fly   234 LKPWILNAI 242
            .:.||.:.|
Human   249 YRKWIKDTI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 79/241 (33%)
Tryp_SPc 24..238 CDD:238113 78/240 (33%)
KLK2NP_005542.1 Tryp_SPc 25..256 CDD:238113 80/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8646
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.