DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG3650

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:240 Identity:80/240 - (33%)
Similarity:126/240 - (52%) Gaps:17/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ISAGSSPERIVGGHPVLISEV-PWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRV 78
            :::|....|||||....:|.| .:...|.|...:.||..:.:...::|||||::....:..:|: 
  Fly    17 LASGQIQPRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAHCLKGYQASRITVQ- 80

  Fly    79 GSVWKNLGGQHARVAVIRKHEDY-----VSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAA 138
            |.|.|     .::..|:|:...|     .||:.|..|:.||||...|. .:.:..|.|.......
  Fly    81 GGVSK-----LSQSGVVRRVARYFIPNGFSSSSLNWDVGVIRLQSALT-GSGITTIPLCQVQWNP 139

  Fly   139 GTEASVSGWGEIGILWLQPTSLLKT-SVKILDPNVCKRSYQ---YITKTMICAAALLKDSCHGDS 199
            |....|||||........|::.|:| .::::...||:|:||   .:|.:..||....||||.|||
  Fly   140 GNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTASTFCARTGGKDSCSGDS 204

  Fly   200 GGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQ 244
            ||.::...||.||||:|:||||..:||||.:|..::.:||.:|::
  Fly   205 GGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFILRSIKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 76/224 (34%)
Tryp_SPc 24..238 CDD:238113 75/223 (34%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 76/224 (34%)
Tryp_SPc 26..243 CDD:238113 75/223 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.