DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG11192

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:262 Identity:102/262 - (38%)
Similarity:139/262 - (53%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LHWLVLVASVTLISAGSSPE----RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAA 63
            |.||:.:.:.    ||::|.    |||||....|.|.|:|.::....::|||..|.....::|||
  Fly     7 LWWLMALVAY----AGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAA 67

  Fly    64 HCVERPFDTL-YSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVR 127
            ||.|.|:.:. |:|||||.....||....:..:..|.|| :.....||:|::.|...|.|...::
  Fly    68 HCFEDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDY-NPQSHDNDLALLILNGQLNFTEHLQ 131

  Fly   128 PIQLADSA--PAAGTEASVSGW----------GEIGILWLQPTSLLKTSVKILDPNVCKRSYQY- 179
            |:.||..|  |.|.|...||||          ||:|:    ...|....|.:::.|.|:|:|.. 
  Fly   132 PVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGV----SPQLRFVDVDLVESNQCRRAYSQV 192

  Fly   180 --ITKTMICAAALLKDSCHGDSGGPLV------SGGQLVGIVSYGIGCANPFFPGVYANVAELKP 236
              ||:.|||||...:|||.||||||||      ...:|.||||:|:|||||.|||||.|||..:.
  Fly   193 LPITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRS 257

  Fly   237 WI 238
            ||
  Fly   258 WI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 94/236 (40%)
Tryp_SPc 24..238 CDD:238113 93/235 (40%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 94/236 (40%)
Tryp_SPc 28..262 CDD:238113 95/237 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443279
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.