DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Ser8

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:249 Identity:110/249 - (44%)
Similarity:148/249 - (59%) Gaps:16/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSSPE------RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAH 64
            |:.:.:..:|..|..|:      |||||....|.:.|||.:|..|..:.||..|.|:.||:||||
  Fly    11 LLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAH 75

  Fly    65 CVERPFDTLYS---VRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEV 126
            |::.|  |..|   :|.||..:..||....||.|:.||.|.|::.: |||.|:||...|.|.:.:
  Fly    76 CLDTP--TTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKI-NDIGVVRLKTKLTFGSTI 137

  Fly   127 RPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRS-YQY---ITKTMICA 187
            :.|.:|.:.||.|:.||:||||:.........:||....:|:..:.|..| |.|   |..|||||
  Fly   138 KAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICA 202

  Fly   188 AALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNA 241
            ||..||:|.|||||||||||||||:||:|..||...:||||||:|||:.|:|.|
  Fly   203 AATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 103/221 (47%)
Tryp_SPc 24..238 CDD:238113 102/220 (46%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 103/221 (47%)
Tryp_SPc 35..253 CDD:238113 102/220 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443204
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.