DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prss3

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:247 Identity:94/247 - (38%)
Similarity:128/247 - (51%) Gaps:14/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVE 67
            |.:|.|| .|.:.......::||||:....:.||:|.:| .|..:.||..:.:|:.:::||||  
  Rat     4 LLFLALV-GVAVAFPVDDDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHC-- 64

  Fly    68 RPFDTLYSVRVGSVWKN-LGG--QHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPI 129
              :.|...||:|....| |.|  |....|.|.||.:: ::..|.|||.:|:|...:..||.|..:
  Rat    65 --YKTRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNF-NARNLNNDIMLIKLSSPVKLNARVATV 126

  Fly   130 QLADSAPAAGTEASVSGWGEIGILWLQPTSLLK-TSVKILDPNVCKRSYQ-YITKTMICAAALL- 191
            .|..|...|||:..:||||....|.:....||: ....:|....|:.||. .||..|||...|. 
  Rat   127 ALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPGKITNNMICVGFLEG 191

  Fly   192 -KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
             ||||.||||||:|..|||.||||:|.|||....||||..|.....||.:.|
  Rat   192 GKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 86/221 (39%)
Tryp_SPc 24..238 CDD:238113 86/220 (39%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 86/221 (39%)
Tryp_SPc 24..242 CDD:238113 88/223 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.