DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG8170

DIOPT Version :10

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:86 Identity:23/86 - (26%)
Similarity:40/86 - (46%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 STAQAAHSRLLWSGCSHQAPVRHFSTEKDTARVEEPTENEKKLTVEVEELRKEAAELTEKVKSLD 80
            |.|:||.|... .|.:.:...|:...||..|.|.| .||.....:::::.|||    .:.|.:|.
  Fly   842 SNAKAAPSATA-DGATAKKKARNLIKEKSVADVAE-KENPISRLMQIQQARKE----KQPVYTLQ 900

  Fly    81 DKYKRALAESENIRRRLTKQI 101
            :..:.|:..    ||:.|.::
  Fly   901 ENDRPAVGR----RRQFTIEV 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 19/79 (24%)
CG8170NP_610441.2 Tryp_SPc 612..846 CDD:238113 2/3 (67%)

Return to query results.
Submit another query.