DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and flz

DIOPT Version :10

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:92 Identity:22/92 - (23%)
Similarity:45/92 - (48%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LTEKVKSLDDKYKRALAESENIRRRLTK-QIDDAKLFGIQGFCKDLLEVAD--ILGHATEAVPKD 133
            ||| ::.::....|:|....|  |.||: .:::..|..|.....:::|:.:  |:..|..|:..|
  Fly    68 LTE-IEIVNGVMLRSLVAGTN--RHLTRLYVENCLLDRIPPTLSNMIELEELLIMQCALTALRLD 129

  Fly   134 EISDKNPHLKNLFEGLSMTRQQLNSVF 160
            .:.: ||.|..    :.:||.::..:|
  Fly   130 VLVN-NPKLTT----IDLTRNRIRQLF 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 22/92 (24%)
flzNP_001137622.1 PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.