DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG17571

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:256 Identity:95/256 - (37%)
Similarity:147/256 - (57%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLVASVTLISAGSSPE----------RIVGGHPVLISEVPWQAALMYSE-KYICGAVIYSDKIII 60
            :|::.|.|::..:|..          |||.|..|.|...|:|.::..:: .:.||..:...:.::
  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVL 68

  Fly    61 TAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAE 125
            |||||::....:...|||||..::.||:...|...:.||.| :|.::.||:|:|:|...:...::
  Fly    69 TAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGY-NSKLMINDVAIIKLSSPVRQTSK 132

  Fly   126 VRPIQLADSAPAAGTEASVSGWGEIGILWL-QPTSLLKTSVKILDPNVCKR-SYQY----ITKTM 184
            :|.|:||||...:||.|.|||||....|:. .|.:|.|..|.:|....|.. :|.|    |.:||
  Fly   133 IRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETM 197

  Fly   185 ICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQL 245
            :||....||:|.||||||||:..:|||:||:|.|||...:|||||:||.|:.||::..:.|
  Fly   198 VCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIVDTTDSL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 88/221 (40%)
Tryp_SPc 24..238 CDD:238113 87/220 (40%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 88/221 (40%)
Tryp_SPc 31..254 CDD:238113 89/223 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443209
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.