DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Send2

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:250 Identity:101/250 - (40%)
Similarity:137/250 - (54%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLHWLVLVASVTLISAG---SSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITA 62
            |.:...:|:.::..:|||   ...|||:||.|:.|.|.|||.::....|::||..|||..|||||
  Fly     1 MFIQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITA 65

  Fly    63 AHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVR 127
            ||||:   ...|.||.||..||..|....||.||.||.      |.||||::||...|.|..:|:
  Fly    66 AHCVQ---GQGYQVRAGSALKNSNGSVVDVAAIRTHEG------LGNDIAIVRLSKPLEFTNQVQ 121

  Fly   128 PIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQYITK-TMICAAALL 191
            ||.||.:.|..|:.|.|||||. ...:..|..|...::.|..|..|.     :|: :.|||.:..
  Fly   122 PIPLAKTNPPPGSIAFVSGWGS-SSYYSHPIDLQGVNLYIQWPYYCG-----LTEPSRICAGSFG 180

  Fly   192 KDSCHGDSGGPLVSGGQLVGIVSYGI-GCANPFFPGVYANVAELKPWILNAIEQL 245
            :.:|.||||||||...||||:||.|. .|.   :..:|.:|...:.||||||:::
  Fly   181 RAACKGDSGGPLVFDQQLVGVVSGGTKDCT---YSSIYTSVPYFREWILNAIDEI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 89/216 (41%)
Tryp_SPc 24..238 CDD:238113 88/215 (41%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 89/216 (41%)
Tryp_SPc 27..225 CDD:238113 88/215 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.