DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Phae1

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:252 Identity:74/252 - (29%)
Similarity:117/252 - (46%) Gaps:22/252 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLIS--AGSSPE-RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVE 67
            |:|:..:..||  |..:|| |:|||.|..::..|:..::.|...:.|.|.|.:...::|||||:.
  Fly    15 LLLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLT 79

  Fly    68 RPFDTLYSVRV-GSVWKNLGG-----QHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEV 126
            .....|.|..| ||:  .:.|     |...:.....::.|...|:.: ||.:|......:::|.|
  Fly    80 NSNQVLGSTLVAGSI--AVDGTASTTQTRSITYFVINDLYTGGTVPY-DIGMIYTPTAFVWSAAV 141

  Fly   127 RPIQLADSAPAAGTEASVSGWGEIGI--LWLQPTSL-LKTSVKILDPNVCKRSY----QYITKTM 184
            .|:.|..|.......|::.|||....  ....|::| :.|:|.|:..:.|:.:.    ..:..|.
  Fly   142 APVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTN 206

  Fly   185 ICAAALL--KDSCHGDSGGPLVSGGQLVGIVSYG-IGCANPFFPGVYANVAELKPWI 238
            :|...|.  ...|..|||||||.|..|:||||:| :.|.....|.||..|:....||
  Fly   207 LCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 65/230 (28%)
Tryp_SPc 24..238 CDD:238113 64/229 (28%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 65/230 (28%)
Tryp_SPc 36..266 CDD:238113 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.