DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Try29F

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:256 Identity:91/256 - (35%)
Similarity:132/256 - (51%) Gaps:27/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLHWL---VLVASVTLISAGSSPE---RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIII 60
            :||..   :|:.:::|.:....|.   |||||....|.::|:|.:|..| .:.||..:.:...::
  Fly    14 ILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS-YHFCGGSLIAQGWVL 77

  Fly    61 TAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAE 125
            |||||.|.....|..||:||...::|||...:..:.:|..:.:.||.| |.:::.|.:....|..
  Fly    78 TAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDF-DFSLLELEEYSAKNVT 141

  Fly   126 VR----PIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNV----CKRSY---QY 179
            ..    |.|.||.|.  ||...|||||....  .|.||.:..||.:  |.|    |..:|   ..
  Fly   142 QAFVGLPEQDADIAD--GTPVLVSGWGNTQS--AQETSAVLRSVTV--PKVSQTQCTEAYGNFGS 200

  Fly   180 ITKTMICAAALL--KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWI 238
            ||..|:||....  ||:|.|||||||.:.|.|.|:||:|.|||.|.:||||:.|:.::.||
  Fly   201 ITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 84/227 (37%)
Tryp_SPc 24..238 CDD:238113 83/226 (37%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 84/227 (37%)
Tryp_SPc 42..264 CDD:238113 85/228 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443383
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.