DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and PRSS53

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:317 Identity:70/317 - (22%)
Similarity:116/317 - (36%) Gaps:89/317 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 W--LVLVASVTLISAG-SSPERIVG----GHP------VLISEVPWQAALMYSEKYICGAVIYSD 56
            |  ::|:|..|::..| .:.:|..|    |.|      .:..|.||||::.....:||...:.:|
Human     5 WGPVLLIAGATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPGEWPWQASVRRQGAHICSGSLVAD 69

  Fly    57 KIIITAAHCVERPFDT---LYSVRVGSVWK---NLGGQHARVAVI---RKHEDYVSSTILFNDIA 112
            ..::|||||.|:...|   .:||.:||:.:   :.|.:...||.:   |.:..|...    :|:|
Human    70 TWVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQG----SDLA 130

  Fly   113 VIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWGE---IGILWLQ------------------ 156
            :::|...........| |.|...| .|.....:||.:   .|..|.:                  
Human   131 LLQLAHPTTHTPLCLP-QPAHRFP-FGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPN 193

  Fly   157 ------------------------PTSLLKTSVKILDPNVCKRSYQYITKT---------MICAA 188
                                    |.:|....::::....|...|..:.:.         |:|..
Human   194 CPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCGG 258

  Fly   189 AL--LKDSCHGDSGGP---LVSGGQLV--GIVSYGIGCANPFFPGVYANVAELKPWI 238
            ..  ::..|.||||||   |...|..|  ||:|:...||....|.:..|.|....|:
Human   259 PQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLLTNTAAHSSWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 64/294 (22%)
Tryp_SPc 24..238 CDD:238113 63/293 (22%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 61/280 (22%)
Tryp_SPc 43..314 CDD:214473 60/276 (22%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.