DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG4271

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:220 Identity:65/220 - (29%)
Similarity:103/220 - (46%) Gaps:28/220 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVS 103
            |::..|..:.||..:...:|::|||.||:.......:||||:.....||:..||..:..||:|.:
  Fly    34 ASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENYKN 98

  Fly   104 STILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWGE-------------IGILWL 155
            ..   ||||::.| :..:.:..|..|.||...|:.....|.:||||             .|:..:
  Fly    99 WD---NDIALLWL-EKPVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKI 159

  Fly   156 QPTSLLKTSVKILDPNVCKRSYQYITKTMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCA 220
            :|.|:  .:.::::|         :.:.::||.....|.|.||.|||||...::|||...|.||.
  Fly   160 RPRSM--CAEELVEP---------VGEELLCAFYTENDICPGDYGGPLVLANKVVGIAVQGHGCG 213

  Fly   221 NPFFPGVYANVAELKPWILNAIEQL 245
            ....|.:|.||.....||....|:|
  Fly   214 FAVLPSLYTNVFHYLEWIEENAEKL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 61/211 (29%)
Tryp_SPc 24..238 CDD:238113 61/211 (29%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 63/214 (29%)
Tryp_SPc 19..231 CDD:214473 61/211 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.