DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Ser6

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:254 Identity:75/254 - (29%)
Similarity:121/254 - (47%) Gaps:25/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHC 65
            :|..:|:.:......:.|....|:|||...:.::.|.|.:|..:..:.||..|.:...|:|||||
  Fly     9 LLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHC 73

  Fly    66 V--------------ERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRL 116
            |              ||     :::|.||..:..||...:||.:..||:|.:   ..||:|::||
  Fly    74 VSNEDVNHVITPIAAER-----FTIRAGSNDRFSGGVLVQVAEVIVHEEYGN---FLNDVALLRL 130

  Fly   117 VDTLIFNAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQYIT 181
            ...||.:|.::||.|......|..:..:||||.|......|..|...::|.:....|:....:..
  Fly   131 ESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDFGF 195

  Fly   182 KTMICAAALLKD-SCHGDSGGPLVSGGQLVGIVSYGI-GCANPFFPGVYANVAELKPWI 238
            :..:|....:.: :|:||||||.|...||||:..:.: ||.:. :|..||.|...|.||
  Fly   196 EGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGST-YPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 70/230 (30%)
Tryp_SPc 24..238 CDD:238113 69/229 (30%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 70/230 (30%)
Tryp_SPc 32..256 CDD:238113 71/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.