DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prss53

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:242 Identity:66/242 - (27%)
Similarity:104/242 - (42%) Gaps:29/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHC-VERPFDTLYSVRV 78
            ::.||.  |..|.....:|:.||.|.|.:..|..||..:.|:.:::||||| :.|.....:||.:
Mouse   294 VACGSL--RSAGPQAGALSQWPWDARLKHHGKLACGGALVSEVVVLTAAHCFIGRQTLEEWSVGL 356

  Fly    79 GSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQL--ADSAPAAGTE 141
            |:     |.:...:..:..|..|......: |:|.:.|...:.....:||:.|  ||.....|..
Mouse   357 GA-----GPEEWGLKQLILHGAYTHPEGGY-DVAFLLLAQPVTLGPGLRPLCLPYADHHLPDGEH 415

  Fly   142 ASVSGWGE-IGILWLQPTSLLKTSVKILDPNVCKRSYQY-------ITKTMICAAALLK-DSCHG 197
            ..|.|..: .||.:.|     ...|.:|.|..|.|.:..       |...|:|...:.: ..|.|
Mouse   416 GWVLGLTQKAGINYPQ-----TVPVTVLGPMACSRQHAAPGGTGIPILPGMVCTTVVGEPPHCEG 475

  Fly   198 DSGGPLVSGGQ----LVGIVSYGIGCANPFFPGVYANVAELKPWILN 240
            .||.|||...:    |||:.|:|..|.:...|.|:|.::..:.||.|
Mouse   476 LSGAPLVHEIRGTWFLVGLHSFGDTCQSSAKPAVFAALSAYEDWISN 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 61/230 (27%)
Tryp_SPc 24..238 CDD:238113 60/229 (26%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113
Tryp_SPc 311..522 CDD:238113 60/221 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.