DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prss34

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:276 Identity:92/276 - (33%)
Similarity:130/276 - (47%) Gaps:47/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLVA--------SVTL-ISAGSSPERIVGGHPVLISEVPWQAAL-MYSEKYI-----CGAVIY 54
            ||:.::        .:|| :.:|.....||||.||..|..|||.:| :|..::.     ||..:.
Mouse     7 WLLFLSLPCLGNTMPLTLDLGSGQGLVGIVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLI 71

  Fly    55 SDKIIITAAHCVERPFDT-LYSVR--VGSVWKNLGGQHARVAVIRKHEDYVSSTILFN--DIAVI 114
            ..:.::|||||| ||.:. .|.||  ||.:......|..:|..|.:|..:........  |||::
Mouse    72 HPQWVLTAAHCV-RPKEVEAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALL 135

  Fly   115 RLVDTLIFNAEVRPIQLADSAPAAGTEAS------VSGWGEI-GILWLQPT-SLLKTSVKILDPN 171
            :|...::.:..|.|:.|    |||....|      |:|||.| ..:.|.|. .|.:.:|.|::.|
Mouse   136 KLDTRVVLSEHVYPVSL----PAASLRISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVENN 196

  Fly   172 VCKRSYQ----------YITKTMICAAALLKDSCHGDSGGPLVSGGQL----VGIVSYGIGCANP 222
            .|::.||          .|...|:||....:|||..|||||||.....    ||:||:||||..|
Mouse   197 DCEQKYQTNSSSDSTTRIIKDDMLCAGKEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLP 261

  Fly   223 FFPGVYANVAELKPWI 238
            .|||||..|.....||
Mouse   262 DFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 85/247 (34%)
Tryp_SPc 24..238 CDD:238113 85/246 (35%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 87/248 (35%)
Tryp_SPc 35..277 CDD:214473 85/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.