DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG9673

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:246 Identity:70/246 - (28%)
Similarity:122/246 - (49%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LISAGSSPE-RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVE----RPFD-T 72
            ::||.:||: ||:||..|...|.||.|::.|::.::|...|.|...|:||||||.    .|.| :
  Fly    18 ILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDAS 82

  Fly    73 LYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQL------ 131
            ..:||:|::.:..||....|..:..|..|.:   ..:|||::.|.:||:|:..::.|.|      
  Fly    83 TLAVRLGTINQYAGGSIVNVKSVIIHPSYGN---FLHDIAILELDETLVFSDRIQDIALPPTTDE 144

  Fly   132 ----ADSAPAAGTEASVSGWGEIG---ILWLQPTSLLKTSVKILDPNVCKRSYQYITKTMIC-AA 188
                .|:....||...|:||||:.   ..:.|.    |.:...|..::|:....|..::::| :.
  Fly   145 ETEDVDAELPNGTPVYVAGWGELSDGTASYKQQ----KANYNTLSRSLCEWEAGYGYESVVCLSR 205

  Fly   189 ALLKDSCHGDSGGPLVSGGQLV-GIVSYGIGCANPFFPGVYANVAELKPWI 238
            |..:..|.||:|..::...::: |:.|:..|.....:|.|...|:....||
  Fly   206 AEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 64/234 (27%)
Tryp_SPc 24..238 CDD:238113 63/233 (27%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 64/234 (27%)
Tryp_SPc 29..259 CDD:238113 65/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.