DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and sphe

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:254 Identity:73/254 - (28%)
Similarity:117/254 - (46%) Gaps:28/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAG--SSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVER 68
            ||::..:.|.:.|  .:..||:||.....:...:.|:|.....::||..|.|...|:|.||||.|
  Fly     6 LVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHR 70

  Fly    69 PFDTL----YSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPI 129
            ....:    .:.||||..:..||:...|..:..|.||.:   |.|::|||.|...|.:...:..|
  Fly    71 DGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYN---LNNNLAVITLSSELTYTDRITAI 132

  Fly   130 QL---ADSAPAAGTEASVSGWGEIGILWLQPTS-------LLKTSVKILDPNVCKRSYQYITKTM 184
            .|   .::.||.|:|..|:|||.        ||       :.:.|:|:.....|..:|....:..
  Fly   133 PLVASGEALPAEGSEVIVAGWGR--------TSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQS 189

  Fly   185 ICAAALLKD-SCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            .|.|..||: :||||.||..:.|..|:|:.::.:|.....:|.|:..::....||...|
  Fly   190 FCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 66/229 (29%)
Tryp_SPc 24..238 CDD:238113 65/228 (29%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 63/215 (29%)
Tryp_SPc 42..244 CDD:214473 61/212 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.