DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG33160

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:236 Identity:84/236 - (35%)
Similarity:118/236 - (50%) Gaps:26/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGG 87
            ||:|||...|.|..:...:..||: :||..:...:.:|||||||.......:.:..|:  .|..|
  Fly    33 RIIGGHVSSIKEEKYLVQVTTSEE-LCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGA--SNQAG 94

  Fly    88 QHARVAVIRKHEDYVSSTILFN------DIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSG 146
            .:|.:..:    ||::....||      |:|.:||...:| .|.:..|.||..:..|.....|||
  Fly    95 PYAVIRTV----DYIAIRPDFNRKTLNMDVAALRLNSDMI-GANIETIPLAAQSVPARALVKVSG 154

  Fly   147 WGEIGILWLQPTSLLKTSVKILDPNVCK-------RSYQYITKTMICAAALL-KDSCHGDSGGPL 203
            |   |.|....|...:....:|.|...:       |....||::|:|||.|. ||||.|||||||
  Fly   155 W---GFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPL 216

  Fly   204 VSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQ 244
            |..|||.||||:|.|||:. .||:|.:|.|::.|....:||
  Fly   217 VYRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVEQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 81/228 (36%)
Tryp_SPc 24..238 CDD:238113 80/227 (35%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 81/227 (36%)
Tryp_SPc 34..253 CDD:238113 81/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.