DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG32834

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:263 Identity:85/263 - (32%)
Similarity:123/263 - (46%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLVASVTLISAG--SSPERIVGGHPVLISEVPWQAALMYSEKYIC-GAVIYSDKIIITAAHCV 66
            :|.|:|::.....|  .:..||:||:.|.|.:.|:||.::.....|| ||:|.|| .|||||.||
  Fly     6 FLFLLAALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSD-TIITAASCV 69

  Fly    67 ERPFDTLYSVRVGSVWKNLGGQH--ARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPI 129
            : .:.:: .||||:..::..|..  ..|..|..|..| :.....|::|:::|.|.|..:..::||
  Fly    70 Q-SYGSI-EVRVGTSSRDYDGTGFLLEVCEIINHPQY-NCWRFDNNLALLKLCDPLKTSEAIQPI 131

  Fly   130 QLADSAPAAGTEASVSGWGEI---GILWLQ-----PTSLLKTSVKILDPNVC-----------KR 175
            .:|:..|..|:..:|||||..   |..|.:     |..|....|.:.:...|           ..
  Fly   132 SIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFGLWDN 196

  Fly   176 SYQYITKTMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILN 240
            ...|:|......|.    .|..|:|.|||..||||||:|.| ||...  |.|||||.....||..
  Fly   197 GISYLTLCTHNGAG----GCSYDTGAPLVIDGQLVGILSEG-GCTTK--PDVYANVPWFTGWIAE 254

  Fly   241 AIE 243
            ..|
  Fly   255 NTE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 78/236 (33%)
Tryp_SPc 24..238 CDD:238113 77/235 (33%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 78/236 (33%)
Tryp_SPc 27..255 CDD:238113 79/238 (33%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.