DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG32523

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:253 Identity:86/253 - (33%)
Similarity:123/253 - (48%) Gaps:26/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLI---------SAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIIT 61
            |:|:..|.:|         |..:...|||||......:.|.|.:|....::.||.||.|...:||
  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVIT 74

  Fly    62 AAHCVERPFDT----LYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIF 122
            |.|||:...|.    |:|::.||:..:..|....||.:..|.:|.:..  .||:||:||...|.|
  Fly    75 AGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG--HNDLAVLRLQSPLTF 137

  Fly   123 NAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCK-RSYQYITKTMIC 186
            :|.:..||||...|.......:||||.|........|||...|..:....|: ..|..:.:||||
  Fly   138 DANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMIC 202

  Fly   187 AAALL--KDS--CHGDSGGPLVSGGQLVGIVS--YGIGCANPFFPGVYANVAELKPWI 238
               ||  |:|  |:||||||...||::||:.|  .|.||... .|..|..:::::.||
  Fly   203 ---LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 79/225 (35%)
Tryp_SPc 24..238 CDD:238113 78/224 (35%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 79/225 (35%)
Tryp_SPc 37..219 CDD:238113 66/186 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.