DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG32376

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:247 Identity:92/247 - (37%)
Similarity:129/247 - (52%) Gaps:38/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWK 83
            |.|.|||.|..:..:|.|:|.:|.|...::||.||.:...|:||.||...|.:. |:|||||..:
  Fly    61 SFPTRIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFGPPEK-YTVRVGSDQQ 124

  Fly    84 NLGGQ--HA-RVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGT----- 140
            ..|||  |. ::..:..:.||.    :.:|:|:::|...:.|...|||::|    |:..|     
  Fly   125 RRGGQLRHVKKIVALAAYNDYT----MRHDLAMMKLKSPVYFGKCVRPVKL----PSTKTTKFPK 181

  Fly   141 EASVSGWGEIGILWLQPTS---------LLKTSVKILDPNVCKRSYQ----YITKTMICAAALLK 192
            :..|||||        .||         |.:..:..:..:.|::.|:    .|.|.||||:...|
  Fly   182 KFVVSGWG--------ITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTNK 238

  Fly   193 DSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQ 244
            |||.|||||||.|.|.|.||||:||||||..:||||.|.....|||...|.:
  Fly   239 DSCSGDSGGPLTSRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWIKKVIHK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 87/235 (37%)
Tryp_SPc 24..238 CDD:238113 86/234 (37%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 87/235 (37%)
Tryp_SPc 66..287 CDD:238113 88/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.