DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Klk14

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_777355.1 Gene:Klk14 / 317653 MGIID:2447564 Length:250 Species:Mus musculus


Alignment Length:255 Identity:93/255 - (36%)
Similarity:132/255 - (51%) Gaps:19/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMY--SEKYICGAVIYSDKIIITAA 63
            |.|..::|.|....|:......:|:||:..:.:..|||.||..  ..:::||.|:.||:.:||||
Mouse     1 MFLLLIILQALAVAIAQSQGDHKIIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAA 65

  Fly    64 HCVERPFDTLYSVRVGSVWKNLGGQHARVAVIR-----KHEDYVSSTILFNDIAVIRLVDTLIFN 123
            ||. ||   :..|.:|.  .|:....|...|:|     .|..| ......||:.:::|...:...
Mouse    66 HCA-RP---ILHVALGK--HNIRRWEATQQVVRVARQVPHPQY-QPQAHDNDLMLLKLQKKVRLG 123

  Fly   124 AEVRPIQLADSAPAAGTEASVSGWGEIGI-LWLQPTSLLKTSVKILDPNVCKRSYQ-YITKTMIC 186
            ..|:.|.:|.|..:.||...|||||.|.. :...||:|...:|.|:....|.|:|. .||..|:|
Mouse   124 RAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVC 188

  Fly   187 AAALL--KDSCHGDSGGPLVSGGQLVGIVSYGI-GCANPFFPGVYANVAELKPWILNAIE 243
            |....  ||||.||||||||.||||.|:||:|: .||.|.:||||||:.....||...::
Mouse   189 AGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 86/226 (38%)
Tryp_SPc 24..238 CDD:238113 86/225 (38%)
Klk14NP_777355.1 Tryp_SPc 24..246 CDD:238113 88/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43743
orthoMCL 1 0.900 - - OOG6_128159
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.