DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG6041

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:270 Identity:82/270 - (30%)
Similarity:131/270 - (48%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLV-----------ASVTLISAGSSPERIVGGHPVLISEVPWQAAL--------MYSEKYICG 50
            |.:|.           .|::..:||....:||||:...|.:|.:|.::        .|...::||
  Fly     5 WAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCG 69

  Fly    51 AVIYSDKIIITAAHCV----ERPFDTL--YSVRVGSVWKNLGGQHARVAVIRK---HEDYVSSTI 106
            .|:.|.:::.|||||.    ::.:.|.  :.:.:||.:.........:..:::   ||:| :...
  Fly    70 GVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENY-NPDA 133

  Fly   107 LFNDIAVIRLVDTLIFN-AEVRPIQLADSAPAAGTEASVSGWGEIGILWLQPT----SLLKTSVK 166
            |.||||::.:...:.:| ..|..:.|.....|..|:..:|||   |:|....|    :|...:|.
  Fly   134 LTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGW---GLLQQNGTFSSNTLQAATVP 195

  Fly   167 ILDPNVCKRSYQYITKTMICAAALL--KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYA 229
            |:....|:.||..|..:.:||..|.  .|:|.||||||:...|.|.||||||.|||.|.:||||.
  Fly   196 IVSYTTCRISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYT 260

  Fly   230 NVAELKPWIL 239
            ||:....||:
  Fly   261 NVSYYYDWIV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 75/238 (32%)
Tryp_SPc 24..238 CDD:238113 75/237 (32%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 75/238 (32%)
Tryp_SPc 35..272 CDD:238113 77/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.