DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prtn3

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:232 Identity:63/232 - (27%)
Similarity:106/232 - (45%) Gaps:31/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGHPVLISEVPWQAALMYSE---KYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKN 84
            :|||||.......|:.|:|..|.   .:.||..:...:.::|||||::.....|.:|.:|:  .:
  Rat   197 KIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGA--HD 259

  Fly    85 L---GGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQL--ADSAPAAGTEASV 144
            |   ..:..:..:.:..|:..:.....||:.:::|........:|....|  .|.:.:.||:...
  Rat   260 LLSSEPEQQKFTITQVFENNYNPEETLNDVLLLQLNRPASLGKQVAVASLPQQDQSLSQGTQCLA 324

  Fly   145 SGWGEIGILWLQPTSLLKTSVKIL-----DPNVCKRSYQYITKTMI--CAAALLKDSCHGDSGGP 202
            .|||.:|.....|..|.:.:|.::     :.|||         |::  .||.:    |.||||||
  Rat   325 MGWGRLGTRAPTPRVLHELNVTVVTFLCREHNVC---------TLVPRRAAGI----CFGDSGGP 376

  Fly   203 LVSGGQLVGIVSYGI-GCANPFFPGVYANVAELKPWI 238
            |:..|.|.|:.|:.| .||:..||..:|.|:....||
  Rat   377 LICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 61/230 (27%)
Tryp_SPc 24..238 CDD:238113 61/229 (27%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 63/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.