DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and LOC312273

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:246 Identity:86/246 - (34%)
Similarity:127/246 - (51%) Gaps:12/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERP 69
            :..|:.:|.......:.:|||||:......||:|.:| .:..:|||..:.:|:.:::||||    
  Rat     6 FFTLLGTVAAFPTEDNDDRIVGGYTCQEHSVPYQVSL-NAGSHICGGSLITDQWVLSAAHC---- 65

  Fly    70 FDTLYSVRVG--SVWKNLGG-QHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQL 131
            :.....||:|  ::::..|. |....|.:..|.||...|: .|||.:|:|......|::|..|.|
  Rat    66 YHPQLQVRLGEHNIYEIEGAEQFIDAAKMILHPDYDKWTV-DNDIMLIKLKSPATLNSKVSTIPL 129

  Fly   132 ADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSY-QYITKTMICAAALL--KD 193
            ....|.||||..|||||.:...:..|:.|......:|..:||.::| :.||..|.|...|.  ||
  Rat   130 PQYCPTAGTECLVSGWGVLKFGFESPSVLQCLDAPVLSDSVCHKAYPRQITNNMFCLGFLEGGKD 194

  Fly   194 SCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQ 244
            ||..|||||:|..|::.||||:|.|||....||||..|.....||...|.:
  Rat   195 SCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWIHQTIAE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 81/220 (37%)
Tryp_SPc 24..238 CDD:238113 80/219 (37%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 82/222 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.