DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and CG14780

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:279 Identity:76/279 - (27%)
Similarity:120/279 - (43%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALM-------YSEKYICGAVIYSDKII 59
            :|.|.:|..:...:.. :...||:.|......|.....::.       :...:|||..:.:.:.:
  Fly    12 ILFWFLLACAAADLQE-NQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKV 75

  Fly    60 ITAAHCVERPFDTLYS-------------VRVGSVWKNLGGQHARVAVIRKHEDYVSSTI----- 106
            :|||||       ||:             |.:|::.:   .:|....::.:    |||..     
  Fly    76 LTAAHC-------LYNNQRKRFRRASEFVVVLGTLNR---FEHRNGTIVSQ----VSSMAYMHTF 126

  Fly   107 ----LFNDIAVIRLVDTLIF------NAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQPTS-- 159
                :.:|:.::.|...|..      :..|.|||||......|....|:|||.     .:.:|  
  Fly   127 SPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGR-----TEQSSLS 186

  Fly   160 --LLKTSVKILDPNVCKRSYQY-ITKTMICAAALL--KDSCHGDSGGPLVSGGQLVGIVSYGIGC 219
              ||..:|..:....|:..|:. :...|:||..|.  .|||.||||||||..|:|||:||:|.||
  Fly   187 NILLTANVSTIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGC 251

  Fly   220 ANPFFPGVYANVAELKPWI 238
            |.|..||||.:|...:.||
  Fly   252 AEPGLPGVYVDVEYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 71/256 (28%)
Tryp_SPc 24..238 CDD:238113 70/255 (27%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 71/256 (28%)
Tryp_SPc 33..271 CDD:238113 72/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.