DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Klk8

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:246 Identity:90/246 - (36%)
Similarity:129/246 - (52%) Gaps:15/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCV 66
            :|.:|::.|...|..|..|  :|:.|........|||.||...|:.:||.|:..|:.::|||||.
  Rat    13 ILLFLLMGAWAGLTRAQGS--KILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTAAHCK 75

  Fly    67 ERPFDTLYSVRVG--SVWK-NLGGQHARVAVIRKHEDYVSST--ILFNDIAVIRLVDTLIFNAEV 126
            :    ..||||:|  |:.| :...|..:||...:|..:.||.  ...:||.:|||.::.....:|
  Rat    76 K----DKYSVRLGDHSLQKRDEPEQEIQVARSIQHPCFNSSNPEDHSHDIMLIRLQNSANLGDKV 136

  Fly   127 RPIQLADSAPAAGTEASVSGWGEIGILWLQ-PTSLLKTSVKILDPNVCKRSYQ-YITKTMICAAA 189
            :||:||:..|..|.:..:||||.:...... |.:|....|||...|.|:|:|. .||:.|:||.:
  Rat   137 KPIELANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGS 201

  Fly   190 LL-KDSCHGDSGGPLVSGGQLVGIVSYGIG-CANPFFPGVYANVAELKPWI 238
            .. .|:|.||||||||..|.|.||.|:|.. |..|..||||..:.....||
  Rat   202 SNGADTCQGDSGGPLVCNGVLQGITSWGSDPCGKPEKPGVYTKICRYTNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 82/223 (37%)
Tryp_SPc 24..238 CDD:238113 82/222 (37%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 82/223 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.