DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Elane

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:261 Identity:78/261 - (29%)
Similarity:118/261 - (45%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHC 65
            |||..|::..::.        ..||||.|......|:..:|.....:.|||.:.:...:::||||
  Rat    18 MLLALLLVCPALA--------SEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHC 74

  Fly    66 VE-RPFDTLYSVRVGSVWKNLGGQHAR--------VAVIRKHEDYVSSTILFNDIAVIRLVDTLI 121
            |. |.|.::..|        ||....|        .:|.|..|:....:.|.|||.:|:|..:..
  Rat    75 VNGRNFQSVQVV--------LGAHDLRRREPTRQIFSVQRIFENGFDPSRLLNDIVIIQLNGSAT 131

  Fly   122 FNAEVRPIQLADSAPAAG------TEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQYI 180
            .||.|:..:|    ||.|      |.....|||.:|.....|:.|.:.:|.:: .|:|:|     
  Rat   132 INANVQVAEL----PAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVV-TNLCRR----- 186

  Fly   181 TKTMICAAALLKDS--CHGDSGGPLVSGGQLVGIVSY--GIGCANPFFPGVYANVAELKPWILNA 241
             :..:|.....:.:  |.||||||||....:.||.|:  | ||.:.|:|..:|.|||...|| |:
  Rat   187 -RVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRG-GCGSGFYPDAFAPVAEFADWI-NS 248

  Fly   242 I 242
            |
  Rat   249 I 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 70/233 (30%)
Tryp_SPc 24..238 CDD:238113 70/232 (30%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 70/233 (30%)
Tryp_SPc 33..249 CDD:238113 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.