DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Klk1c3

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:259 Identity:79/259 - (30%)
Similarity:123/259 - (47%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLVASVTLISAGSSP---ERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCV 66
            :|:|..:::|....::|   .|:|||.....:..|||.|::..:  :||.|:.....:|||||| 
  Rat     3 FLILFLALSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAVINED--LCGGVLIDPSWVITAAHC- 64

  Fly    67 ERPFDTLYSVRVGSVWKNLGG--QHARVAVIRKHEDYVSSTI---------LFNDIAVIRLVDTL 120
               :...|.|.:|.  .||..  ||..|:...:|.||....:         ..||:.::.|.:..
  Rat    65 ---YSDNYHVLLGQ--NNLSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLLHLSEPA 124

  Fly   121 IFNAEVRPIQLADSAPAAGTEASVSGWGEIG-ILWLQPTSLLKTSVKILDPNVCKRSY-QYITKT 183
            .....|:.|.|....|..|:...|||||... ..|..|..|...::.:|....|.::| :.:|..
  Rat   125 DITDGVKVIDLPTKEPKVGSTCLVSGWGSTNPSEWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDL 189

  Fly   184 MICAAALL--KDSCHGDSGGPLVSGGQLVGIVSYG-IGCANPFFPGVYANVAELKPWILNAIEQ 244
            |:||..|.  ||:|.|||||||:..|.|.||.|:| :.|..|..||:|..:.:...||...:::
  Rat   190 MLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKFTSWIKEVMKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 73/230 (32%)
Tryp_SPc 24..238 CDD:238113 72/229 (31%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 73/230 (32%)
Tryp_SPc 25..250 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.