DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Klk11

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:258 Identity:88/258 - (34%)
Similarity:125/258 - (48%) Gaps:36/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHC 65
            |:|.::.| |.||....|.:  ||:.|:.......|||.||....:.:|||.:.:.|.::|||||
  Rat    31 MILRFIAL-ALVTGHVGGET--RIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHC 92

  Fly    66 VERPFDTLYSVRVG--SVWKNLGGQHARVAV-------------IRKHEDYVSSTILFNDIAVIR 115
             .:|.   |.:.:|  ::.|..|.:..|:|.             .:.|.         |||.:::
  Rat    93 -RKPH---YVILLGEHNLEKTDGCEQRRMATESFPHPGFNNSLPNKDHR---------NDIMLVK 144

  Fly   116 LVDTLIFNAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQ-PTSLLKTSVKILDPNVCKRSYQ- 178
            :.........|||:.|:.....|||...:||||......|: |.||...:|.|:....|:|:|. 
  Rat   145 MSSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECERAYPG 209

  Fly   179 YITKTMICAAALL--KDSCHGDSGGPLVSGGQLVGIVSYGIG-CANPFFPGVYANVAELKPWI 238
            .||.||:||:...  ||||.||||||||..|.|.||:|:|.. ||....||||..|.:...||
  Rat   210 NITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 79/234 (34%)
Tryp_SPc 24..238 CDD:238113 78/233 (33%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 79/234 (34%)
Tryp_SPc 51..275 CDD:238113 80/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.