DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prss38

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:254 Identity:72/254 - (28%)
Similarity:122/254 - (48%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LISAGSSPE---RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCV--ERPFDTL 73
            |.||...|.   :::||...:..:.|||.::.|:..::||..|.:...::|||||.  |:...| 
  Rat   101 LSSACGQPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCFAREKRLQT- 164

  Fly    74 YSVRVGSVWKNLGGQHARVAVIRK---HEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSA 135
            :.:.||.....:..:|.:...|.:   |..:.....:..|:|:::....::|:..|.||.|    
  Rat   165 FDMYVGITNLEVANKHTQWFEINQVIIHPTFEMFHPVGGDVALVQSKSAIVFSDYVLPICL---- 225

  Fly   136 PAAGTEAS-----VSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSY---QYITKTMICAAAL-- 190
            |::....|     .:|||.:.........||:..:.::....|:..|   .|:...|:||..:  
  Rat   226 PSSNLNLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPEMLCAGDIKN 290

  Fly   191 LKDSCHGDSGGPLV----SGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQL 245
            :|:.|.||||.|||    .....:||||:|.|||.|.:|||:|||:....||...:|.:
  Rat   291 MKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWIRYNMETI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 65/233 (28%)
Tryp_SPc 24..238 CDD:238113 65/232 (28%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 66/231 (29%)
Tryp_SPc 116..342 CDD:214473 65/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.