DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prss3b

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:249 Identity:83/249 - (33%)
Similarity:123/249 - (49%) Gaps:17/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVE 67
            |.:|..:.:...:......::||||:....:.:|:|.:| .:..:.||..:.:.:.:::||||  
  Rat     4 LIFLAFLGAAVALPLDDDDDKIVGGYTCQKNSLPYQVSL-NAGYHFCGGSLINSQWVVSAAHC-- 65

  Fly    68 RPFDTLYSVRVGSVWKNL-----GGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVR 127
              :.:...||:|.  .|:     |.|....|.|.:|..|.::| ..|||.:|:|......|:.|.
  Rat    66 --YKSRIQVRLGE--HNIDVVEGGEQFIDAAKIIRHPSYNANT-FDNDIMLIKLNSPATLNSRVS 125

  Fly   128 PIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLK-TSVKILDPNVCKRSYQ-YITKTMICAAAL 190
            .:.|..|..::||:..|||||..........|||: ....:|..:.||.||. .||..|.|...|
  Rat   126 TVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSSYPGKITSNMFCLGFL 190

  Fly   191 L--KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            .  ||||.||||||:|..|||.|:||:|.|||....||||..|.....||...:
  Rat   191 EGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQQTV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 79/223 (35%)
Tryp_SPc 24..238 CDD:238113 79/222 (36%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 79/223 (35%)
Tryp_SPc 25..243 CDD:238113 81/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.