DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prtn3

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:262 Identity:70/262 - (26%)
Similarity:115/262 - (43%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSE---KYICGAVIYSDKIIITAAH 64
            :|..:|:|.|  :.......:|||||.......|:.|:|..|.   .:.||..:...:.::||||
Mouse    11 IHPFLLLALV--VGGAVQASKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAH 73

  Fly    65 CVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTIL---------FNDIAVIRLVDTL 120
            |::.....|.:|.:|:        |..::...:.:.:..|.:.         .||:.:::|..|.
Mouse    74 CLQDISWQLVTVVLGA--------HDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLLLQLNRTA 130

  Fly   121 IFNAEVRPIQL--ADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKIL-----DPNVCKRSYQ 178
            ....||....|  .|...:.||:....|||.:|.....|..|.:.:|.::     :.|||     
Mouse   131 SLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVVTFLCREHNVC----- 190

  Fly   179 YITKTMI--CAAALLKDSCHGDSGGPLVSGGQLVGIVSYGI-GCANPFFPGVYANVAELKPWILN 240
                |::  .||.:    |.|||||||:..|.|.|:.|:.| .||:..||..:|.|:....||.|
Mouse   191 ----TLVPRRAAGI----CFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDWIQN 247

  Fly   241 AI 242
            .:
Mouse   248 VL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 63/236 (27%)
Tryp_SPc 24..238 CDD:238113 63/235 (27%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 63/236 (27%)
Tryp_SPc 30..248 CDD:238113 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.