DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and try-1

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:233 Identity:82/233 - (35%)
Similarity:105/233 - (45%) Gaps:22/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGHPVLISEVPWQAALMYS-EKYICGAVIYSDKIIITAAHCV---ERPFDTLYSVRVGSVWK 83
            |::||........||...|:.. ..:.||..:.....::|||||.   .||  |.||||||....
 Worm    57 RLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRP--TSYSVRVGGHRS 119

  Fly    84 NLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTE-ASVSGW 147
            ..|..| ||..:..|..|........|.|::|:...:..:...|||.| .|.||.... ..|:||
 Worm   120 GSGSPH-RVTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICL-PSLPAVENRLCVVTGW 182

  Fly   148 GEI--GILWLQPTSLLKTSVKILDPNVCKRSYQYITK----TMICAAALLK--DSCHGDSGGPLV 204
            |..  |.....|| |.:..|.:|....|.....||.:    :|:||.....  |||.|||||||:
 Worm   183 GSTIEGSSLSAPT-LREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLM 246

  Fly   205 SG----GQLVGIVSYGIGCANPFFPGVYANVAELKPWI 238
            ..    .:|.|:||:|||||.|..||||.||.....||
 Worm   247 CARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 80/231 (35%)
Tryp_SPc 24..238 CDD:238113 79/230 (34%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 81/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.