DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Egfbp2

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:260 Identity:79/260 - (30%)
Similarity:120/260 - (46%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLVLVASVTLISAGSSP---ERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCV 66
            :|:|..:::|....::|   .|:|||.....:..|||.|:.|.:::|||.|:.....::|||||.
Mouse     3 FLILFLALSLGGIDAAPPLQSRVVGGFNCKKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCY 67

  Fly    67 ERPFDTLYSVRVGSVW--KNL------GGQHARVAVIRKHEDYVSSTILF----------NDIAV 113
            ...::         ||  ||.      ..||..|:....|..:..|.::.          ||:.:
Mouse    68 VDQYE---------VWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSNDLML 123

  Fly   114 IRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWGEI-GILWLQPTSLLKTSVKILDPNVCKRSY 177
            :||.........|:||.|....|..|::...||||.| ...|.:|..|....:.:|....|.:.|
Mouse   124 LRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPTRWQKPDDLQCVFITLLPNENCAKVY 188

  Fly   178 -QYITKTMICAAAL--LKDSCHGDSGGPLVSGGQLVGIVSYG-IGCANPFFPGVYANVAELKPWI 238
             |.:|..|:||..:  .||:|..||||||:..|.|.|..||| :.|..|..|.:|.|:.:...||
Mouse   189 LQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWI 253

  Fly   239  238
            Mouse   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 73/237 (31%)
Tryp_SPc 24..238 CDD:238113 72/236 (31%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 73/237 (31%)
Tryp_SPc 25..256 CDD:238113 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.