DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Prss29

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:282 Identity:91/282 - (32%)
Similarity:139/282 - (49%) Gaps:48/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSS--------PE----RIVGGHPVLISEVPWQAALMYSEKY------ICGAV 52
            :::...:||...|.|        ||    .|||||.....:.|||.:|.....|      .||..
Mouse     1 MLIQLCLTLFFLGCSIAGTPAPGPEGVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGS 65

  Fly    53 IYSDKIIITAAHCV-ERPFD-TLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIR 115
            |...:.::|||||: ||..| :::.:|||..:...|.:...|:.:..|.|:|.:. |.:|:|:::
Mouse    66 IIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAG-LGSDVALLQ 129

  Fly   116 LVDTLIFNAEVRPIQLADSAPAAGTEAS------VSGWGEIGI--LWLQPTSLLKTSVKILDPNV 172
            |..::.....|:|::|    |:...|.:      |:|||.:..  ....|..|.:..|||:|.::
Mouse   130 LAVSVQSFPNVKPVKL----PSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSL 190

  Fly   173 CKRSY-----------QYITKTMICAAALLKDSCHGDSGGPLV----SGGQLVGIVSYGIGCANP 222
            |:..|           :.|.|.|:||....:|||:||||||||    ....|||:||:|.|||..
Mouse   191 CEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALR 255

  Fly   223 FFPGVYANVAELKPWILNAIEQ 244
            .||||||.|....|||...:::
Mouse   256 DFPGVYARVQSFLPWITQQMQR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 83/245 (34%)
Tryp_SPc 24..238 CDD:238113 83/244 (34%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 85/247 (34%)
Tryp_SPc 31..271 CDD:214473 83/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.