DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and LOC105945797

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_031761518.1 Gene:LOC105945797 / 105945797 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:246 Identity:83/246 - (33%)
Similarity:121/246 - (49%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPF 70
            |:|:..:...:|....::||||:....:.||:..:| .:..:.||..:.|.:.:::||||    |
 Frog     3 LLLLCVLLGAAAAFDDDKIVGGYTCAPNSVPYIVSL-NAGYHFCGGSLISSQWVVSAAHC----F 62

  Fly    71 DTLYSVRVG--SVWKNLG-GQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLA 132
            .....||:|  .:....| .|....|.:.|::.| |...|.|||.:|:|....|.|..|.|:.|.
 Frog    63 MNKIEVRLGEHDIKATEGTEQFINSAKVIKNKGY-SPRTLDNDIMLIKLATPAILNQYVSPVPLP 126

  Fly   133 DSAPAAGTEASVSGWGEI---GILWLQPTSLLKTSVKILDPNVCKRSYQ-YITKTMICAAALL-- 191
            ...........:||||..   |..:  |..|...|..:|..:.|.::|. .||:.|||...|.  
 Frog   127 SGCIEPRANCLISGWGNTLSSGSNY--PNLLQCVSAPVLTADECNKAYPGEITQNMICVGFLEGG 189

  Fly   192 KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            ||||.||||||:|..|:|.||||:|.|||...:||||..|.....||.:.:
 Frog   190 KDSCQGDSGGPVVCNGELQGIVSWGYGCAEKNYPGVYTKVCNYNAWIESTV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 78/223 (35%)
Tryp_SPc 24..238 CDD:238113 78/222 (35%)
LOC105945797XP_031761518.1 Tryp_SPc 21..239 CDD:238113 80/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.