DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Try5

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:247 Identity:91/247 - (36%)
Similarity:125/247 - (50%) Gaps:14/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVE 67
            |.:|.||.:...... ...::||||:....:.:|:|.:| .|..:.||..:.:|:.:::||||  
Mouse     4 LLFLALVGAAVAFPV-DDDDKIVGGYTCRENSIPYQVSL-NSGYHFCGGSLINDQWVVSAAHC-- 64

  Fly    68 RPFDTLYSVRVGSVWKNL---GGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPI 129
              :.|...||:|....|:   ..|....|.|.||.::.|.| |.|||.:|:|...:..||.|..:
Mouse    65 --YKTRIQVRLGEHNINVLEGNEQFVNSAKIIKHPNFNSRT-LNNDIMLIKLASPVTLNARVATV 126

  Fly   130 QLADSAPAAGTEASVSGWGEIGILWLQPTSLLK-TSVKILDPNVCKRSYQ-YITKTMICAAALL- 191
            .|..|...|||:..:||||......:....||: ....:|....|:.||. .||..|||...|. 
Mouse   127 ALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYPGKITNNMICVGFLEG 191

  Fly   192 -KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
             ||||.||||||:|..|||.||||:|.|||....||||..|.....||.:.|
Mouse   192 GKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 84/221 (38%)
Tryp_SPc 24..238 CDD:238113 84/220 (38%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 84/221 (38%)
Tryp_SPc 24..242 CDD:238113 86/223 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.