DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Klk9

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:257 Identity:86/257 - (33%)
Similarity:127/257 - (49%) Gaps:29/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPF 70
            |.||....|.....:..|.||....:.:..||||.|.|..:.:|||.:.:|:.::||||| .:|:
Mouse     5 LTLVLFSLLAGHCGADTRAVGARECVRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHC-RKPY 68

  Fly    71 DTLYSVRVGSVWKNLGGQH----------ARVAVIRKHEDY---VSSTILFNDIAVIRLVDTLIF 122
                      :|..||..|          ..|.....|..:   :|:....:||.:|||...:..
Mouse    69 ----------LWVRLGEHHLWRWEGPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRL 123

  Fly   123 NAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQ-PTSLLKTSVKILDPNVCKRSYQ-YITKTMI 185
            ...|:|:.|.:|.|..||:..:||||.:....|| |.:|...::.|||..:|:.:|. :|::.|:
Mouse   124 TPAVQPLNLTESRPPVGTQCLISGWGSVSSSKLQYPMTLQCANISILDNKLCRWAYPGHISEKML 188

  Fly   186 CAAALL--KDSCHGDSGGPLVSGGQLVGIVSYGI-GCANPFFPGVYANVAELKPWILNAIEQ 244
            ||....  :.||.||||||||..|.|.||||.|. .|:.|..|.||.||.:...||.:.:|:
Mouse   189 CAGLWEGGRGSCQGDSGGPLVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFDYLEWIESTMEK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 79/232 (34%)
Tryp_SPc 24..238 CDD:238113 78/231 (34%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6203
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.