DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and LOC100485189

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:243 Identity:73/243 - (30%)
Similarity:110/243 - (45%) Gaps:40/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLG 86
            :||:||.....:..||..:|.|.::::||.|:..:..::|||||           ::.|:...||
 Frog    20 DRIIGGTECRPNSQPWHCSLYYFDQHVCGGVLIDENWVLTAAHC-----------QLSSLQVRLG 73

  Fly    87 GQHARVAVIRKHEDYVS--------STILF-NDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEA 142
            ..:..|...::...|..        :.|.| |||.:::||..:..|..|:.|.|.......|...
 Frog    74 EHNLAVYEGKEQFSYAEKMCPHSGFNPITFDNDIMLLKLVSPVTINDYVQTIPLGCPTVGDGETC 138

  Fly   143 SVSGWG------EIGILWLQPTSLLKTSVKILDPNVCKRSY--QYITKTMICAAALL--KDSCHG 197
            .|||||      |     ..|..|....|:.:..:.|:.::  ..||..|:||..:.  ||||.|
 Frog   139 LVSGWGTTTSPEE-----TFPDELQCVEVQTVSQDYCQGAFPTDEITDNMLCAGVMEGGKDSCQG 198

  Fly   198 DSGGPLVSGGQLVGIVSYG---IGCANPFFPGVYANVAELKPWILNAI 242
            |||||||....:.||.|:|   .|.||.  ||:|..:.....||.:.|
 Frog   199 DSGGPLVCNSMVHGITSWGNTPCGVANK--PGIYTKICNYIAWIQDTI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 70/236 (30%)
Tryp_SPc 24..238 CDD:238113 69/235 (29%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.