DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser12 and Gm10334

DIOPT Version :9

Sequence 1:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:230 Identity:88/230 - (38%)
Similarity:121/230 - (52%) Gaps:17/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNL- 85
            ::||||:....:.||:|.:| .|..:.||..:.:|:.:::||||    :.|...||:|....|: 
Mouse    22 DKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHC----YKTRIQVRLGEHNINVL 81

  Fly    86 --GGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWG 148
              ..|....|.|.||.::...| |.|||.:|:|...:..||.|..:.|..|...|||:..:||||
Mouse    82 EGNEQFVNAAKIIKHPNFNRKT-LNNDIMLIKLSSPVTLNARVATVALPSSCAPAGTQCLISGWG 145

  Fly   149 ---EIGILWLQPTSLLKTSVKILDPNVCKRSYQ-YITKTMICAAALL--KDSCHGDSGGPLVSGG 207
               ..|:  .:|..|......:|....|:.||. .||..|:||..|.  ||||.||||||:|..|
Mouse   146 NTLSFGV--SEPDLLQCLDAPLLPQADCEASYPGKITGNMVCAGFLEGGKDSCQGDSGGPVVCNG 208

  Fly   208 QLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242
            :|.||||:|.|||.|..||||..|.....||.:.|
Mouse   209 ELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 85/223 (38%)
Tryp_SPc 24..238 CDD:238113 85/222 (38%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 87/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.