DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4267 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:282 Identity:78/282 - (27%)
Similarity:128/282 - (45%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LIPFTSSRGKMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKV 126
            |:|::..:...:|:|:..:.....:.|.:.|...:..|.|....:||.:|||::.:.:.:.:..:
  Rat    44 LLPWSPEKINTRFLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDM 108

  Fly   127 -KNAYLSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEAN 190
             ||.:             ..|:.|.|..||.|.| ...|.:.|..|..:||.:|:::..|.:..:
  Rat   109 CKNMF-------------QVEEVNCICVDWKKGS-QTTYTQAANNVRVVGAQVAQMIDILVKNYS 159

  Fly   191 MHYDDVYVIGHSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQT 255
            .....|::|||||||.:||.||.:..  ....|..|||....|....:|.|:|.|||.:|:.|.|
  Rat   160 YSPSKVHLIGHSLGAHVAGEAGSRTP--GLGRITGLDPVEANFEGTPEEVRLDPSDADFVDVIHT 222

  Fly   256 S-------VSFGFEQPVGHATFYPNYGKNQKKC--------------------YVYGCSHKRSHD 293
            .       :.||..|..||..|:||.|::...|                    :| .|:|.||:.
  Rat   223 DAAPLIPFLGFGTNQMSGHLDFFPNGGQSMPGCKKNALSQIVDIDGIWSGTRDFV-ACNHLRSYK 286

  Fly   294 YFIESLTSPAGFWGPRCERHDD 315
            |::||:.:|.||....|..:.|
  Rat   287 YYLESILNPDGFAAYPCASYKD 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 77/280 (28%)
Pancreat_lipase_like 71..347 CDD:238363 76/273 (28%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 78/282 (28%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338970
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.